SNRPB2, Recombinant, Human, aa1-225, His-SUMO-Tag (U2 Small Nuclear Ribonucleoprotein B)

Catalog No : USB-375358
428.75€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name SNRPB2, Recombinant, Human, aa1-225, His-SUMO-Tag (U2 Small Nuclear Ribonucleoprotein B)
Catalog No USB-375358
Supplier’s Catalog No 375358
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 41.5
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Involved in pre-mRNA splicing. This protein is associated with snRNP U2. It binds stem loop IV of U2 snRNA only in presence of the U2A' protein. Source: Recombinant protein corresponding to aa1-225 from human SNRPB2, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~41.5kD AA Sequence: MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.