GHRL, Recombinant, Human, aa1-117, GST-Tag (Appetite-regulating Hormone)

Catalog No : USB-373433
428.75€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name GHRL, Recombinant, Human, aa1-117, GST-Tag (Appetite-regulating Hormone)
Catalog No USB-373433
Supplier’s Catalog No 373433
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 39.9
Storage -20°C
Other names
Grade Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Ghrelin is the ligand for growth hormone secretagogue receptor type 1 (GHSR). Induces the release of growth hormone from the pituitary. Has an appetite-stimulating effect, induces adiposity and stimulates gastric acid secretion. Involved in growth regulation. Obestatin may be the ligand for GPR39. May have an appetite-reducing effect resulting in decreased food intake. May reduce gastric emptying activity and jejunal motility. Source: Recombinant protein corresponding to aa1-117 from human GHRL, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.9kD AA Sequence: MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDEMEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.