ErbB3 Fragment, Recombinant, Human, His-Tag (ErbB3-f)
Catalog No : USB-360196
477.02€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | ErbB3 Fragment, Recombinant, Human, His-Tag (ErbB3-f) | ||
|---|---|---|---|
| Catalog No | USB-360196 | ||
| Supplier’s Catalog No | 360196 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 34 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~95% (SDS-PAGE, HPLC) | ||
| Form | Supplied as a suspension in 1mg aluminum hydroxide, small amount of arginine, sodium chloride, sodium phosphate, potassium phosphate. Reconstitute with sterile dH2O, 0.1% BSA to 0.1-1mg/ml. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~95% (SDS-PAGE, HPLC) | ||
| Description | Source: Recombinant protein corresponding to human ErbB3 Fragment, a single non-glycosylated fusion polypeptide chain, containing 171aa (Ser20- Cys190) with N-terminus Thioredoxin Tag and His-Tag, expressed in E. coli. Molecular Weight: ~34kD (170aa) Applications: Suitable for use in SDS-PAGE. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Biological Activity: Measured by its ability to postpone tumor emerge time of spontaneous breast cancer in FVB/N transgenic mice and inhibit the development of tumor, effectively inhibit the growth of in situ transplanted breast cancer in FVB/N transgenic mice. Endotoxin: <1EU/ug (LAL) AA Sequence: MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHP DLGTDDDDKAMADIGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYN TNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVC Storage and Stability: May be stored at -20°C. Reconstitute with sterile dH2O, 0.1% BSA. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved