Bglap, Recombinant, Mouse, aa50-95, His-SUMO-Tag (Osteocalcin)

Catalog No : USB-372446
471.28€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Bglap, Recombinant, Mouse, aa50-95, His-SUMO-Tag (Osteocalcin)
Catalog No USB-372446
Supplier’s Catalog No 372446
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 21.1
Storage -20°C
Other names
Grade Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium. Source: Recombinant protein corresponding to aa50-95 from mouse Osteocalcin, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~21.1kD AA Sequence: YLGASVPSPDPLEPTREQCELNPACDELSDQYGLKTAYKRIYGITI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.