Neuropeptide Tyrosine, Human (Neuropeptide Y, NPY)
Catalog No : USB-N2176-62Z
473.58€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Neuropeptide Tyrosine, Human (Neuropeptide Y, NPY) | ||
|---|---|---|---|
| Catalog No | USB-N2176-62Z | ||
| Supplier’s Catalog No | N2176-62Z | ||
| Supplier | US Biologicals | ||
| Source antigen | Synthetic peptide | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 4271.8 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~97% (HPLC) | ||
| Form | Supplied as a liquid. | ||
| Reactivity life | 12 months | ||
| Note | For reserch purpose only | ||
| Purity | ~97% (HPLC) | ||
| Description | Source: Synthetic peptide corresponding to YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQYNH2 of human neuropeptide Y. Molecular Weight: 4271.8amu Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. For long-term storage, aliquot and store at -20°C. Aliquots are stable for at least 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved