Lymphotoxin beta Receptor, Murine/Human IgG1 Fc Fusion Protein (LTBR, LT-beta-R, Tumor Necrosis Factor C Receptor, Tumor Necrosis Factor Receptor Superfamily Member 3) (Preservative Free)
Catalog No : USB-L8015-04
711.51€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Lymphotoxin beta Receptor, Murine/Human IgG1 Fc Fusion Protein (LTBR, LT-beta-R, Tumor Necrosis Factor C Receptor, Tumor Necrosis Factor Receptor Superfamily Member 3) (Preservative Free) | ||
|---|---|---|---|
| Catalog No | USB-L8015-04 | ||
| Supplier’s Catalog No | L8015-04 | ||
| Supplier | US Biologicals | ||
| Source antigen | HEK293 cells | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 48.8 | ||
| Storage | -70°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ≥90% by SDS-PAGE | ||
| Form | Supplied as a liquid in 10 mM phosphate, 138 mM sodium chloride and 2.7mM potassium chloride, pH 7.4. Endotoxin: ~0.001EU/ug. | ||
| Reactivity life | 12 months | ||
| Note | For reserch purpose only | ||
| Purity | ≥90% by SDS-PAGE | ||
| Description | A soluble fusion protein consisting of 10 residual amino acids from murine CD8 alpha leader sequence (KPQAPELRGS), followed by the mature extracellular domain of murine LTbR (aa 28-221) fused to human IgG1 Fc. Molecular weight: 48.8kD. This protein runs at a higher apparent MW by SDS-PAGE due to glycosylation. Amino Acid Sequence: KPQAPELRGSSQPQLVPPYRIENQTCWDQDKEYYEPMHDVCCSRCPPGEFVFAVCSRSQDTVCKTCPHNSYNEHWNHLSTCQLCRPCDIVLGFEEVAPCTSDRKAECRCQPGMSCVYLDNECVHCEEERLVLCQPGTEAEVTDEIMDTDVNCVPCKPGHFQNTSSPRARCQPHTRCEIQGLVEAAPGTSYSDTICKNPPEPGAMPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Mouse CD8 signal peptide and linker: KPQAPELRGS Mouse LTBR (a.a. 28-221): SQPQL......EPGAM Fc of human IgG1, Accession #P01857 (a.a.100-330): PKSCD....LSPGK Transfectant Cell Line: HEK293 Applications: Suitable for the use in the study of enzyme kinetics, screening inhibitors and selectively profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: For long-term storage, aliquot to avoid repeated freezing and thawing and freeze at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Aliquots are stable for 6 months. | ||
Product Details
© 2020 Imugex All Rights Reserved