B7-H5, Recombinant, Human (Platelet Receptor Gi24 Dies1, VISTA, SISP1)
Catalog No : USB-172316
598.87€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | B7-H5, Recombinant, Human (Platelet Receptor Gi24 Dies1, VISTA, SISP1) | ||
|---|---|---|---|
| Catalog No | USB-172316 | ||
| Supplier’s Catalog No | 172316 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 46.7 | ||
| Storage | -70°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% | ||
| Form | Supplied as a liquid in 40mM Tris, pH 8.0, 110mM NaCl, 2.2mM KCl, 20% glycerol. | ||
| Reactivity life | 12 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% | ||
| Description | Human secreted B7-H5, Fc fusion protein, also known as Gi24, Dies1, VISTA, and SISP1. Source: Recombinant protein corresponding to aa33-194 from human B7-H5, expressed in HEK293 cell expression system. Molecular Weight: ~46.7kD AA Sequence: FKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPI RNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCC LVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAIEGRMDPKS CDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNW YVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI SKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTT PPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK* Endotoxin: <0.1EU/ug Applications: Suitable for use in studying protein binding and screening small molecules. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. | ||
Product Details
© 2020 Imugex All Rights Reserved