LDLR, Recombinant, Human (FH, FHC, LDLR, LDLCQ2, Low Density Lipoprotein Receptor)
Catalog No : USB-172337
705.77€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | LDLR, Recombinant, Human (FH, FHC, LDLR, LDLCQ2, Low Density Lipoprotein Receptor) | ||
|---|---|---|---|
| Catalog No | USB-172337 | ||
| Supplier’s Catalog No | 172337 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, HEK293 cells | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 87.4 | ||
| Storage | -70°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~87% | ||
| Form | Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM NaCl, 2.2mM KCl, 20% glycerol. | ||
| Reactivity life | 12 months | ||
| Note | For reserch purpose only | ||
| Purity | ~87% | ||
| Description | Binds LDL, the major cholesterol-carrying lipoprotein of plasma, and transports it into cells by endocytosis. In order to be internalized, the receptor-ligand complexes must first cluster into clathrin-coated pits. In case of HIV-1 infection, functions as a receptor for extracellular Tat in neurons, mediating its internalization in uninfected cells. Source: Recombinant protein corresponding to aa22-788 from human LDLR at C-terminal, expressed in HEK293 cell expression system. Molecular Weight: ~87.4kD AA Sequence: AVGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCG GRVNRCIPQFWRCDGQVDCDNGSDEQGCPPKTCSQDEFRCHDGKCISRQFVCDSDR DCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLY VFQGDSSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCAVATCRPDEFQCS DGNCIHGSRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSGECITLDKVCNMAR DCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDE CQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYLFFTNRHEVRKMTL DRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGVSSYDTVISRDI QAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGF MYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSI DVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLL SPEDMVLFHNLTQPRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGML LARDMRSCLTEAEAAVATQETSTVRLKVSSTAVRTQHTTTRPVPDTSRLPGATPGLT TVEIVTMSHQALGDVAGRGNEKKPSSVRDYKDDDDK Applications: Suitable for use in studying protein binding and screening small molecules for drug discovery. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. | ||
Product Details
© 2020 Imugex All Rights Reserved