LTBR, Recombinant, Mouse (Lymphotoxin beta Receptor, mLTBR, mLTBR-Fc fusion Protein, Tumor Necrosis Factor C Receptor, TNFCR, CD18)
Catalog No : USB-172340
590.82€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | LTBR, Recombinant, Mouse (Lymphotoxin beta Receptor, mLTBR, mLTBR-Fc fusion Protein, Tumor Necrosis Factor C Receptor, TNFCR, CD18) | ||
|---|---|---|---|
| Catalog No | USB-172340 | ||
| Supplier’s Catalog No | 172340 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 48.8 | ||
| Storage | -70°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% | ||
| Form | Supplied as a liquid in 10mM phosphate, pH 7.4, 138mM NaCl, 2.7mM KCl. | ||
| Reactivity life | 12 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% | ||
| Description | Receptor for the heterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT. Promotes apoptosis via TRAF3 and TRAF5. May play a role in the development of lymphoid organs By similarity. Source: Recombinant Fc fusion protein corresponding to aa28-221 from mouse LTBR, expressed in HEK293 cell expression system. Molecular Weight: ~48.8kD AA Sequence: KPQAPELRGSSQPQLVPPYRIENQTCWDQDKEYYEPMHDVCCSRCPPGEFVFAVCSR SQDTVCKTCPHNSYNEHWNHLSTCQLCRPCDIVLGFEEVAPCTSDRKAECRCQPGMS CVYLDNECVHCEEERLVLCQPGTEAEVTDEIMDTDVNCVPCKPGHFQNTSSPRARCQ PHTRCEIQGLVEAAPGTSYSDTICKNPPEPGAMPKSCDKTHTCPPCPAPELLGGPSVFL FPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTY RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELT KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSPGK Endotoxin: <0.001EU/ug Applications: Suitable for use in the study of enzyme kinetics, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. | ||
Product Details
© 2020 Imugex All Rights Reserved