Imugex

Shipping cost plus VAT not included , delivery in 7-14 business days

Categories: Peptides & Proteins / Proteins

Product name			GABRA4, Recombinant, Human, aa401-500 (Gamma-aminobutyric Acid A Receptor, alpha 4)
Catalog No			USB-207653
Supplier’s Catalog No			207653
Supplier			US Biologicals
Source antigen			Recombinant, wheat germ
Reactivity
Cross reactivity
Applications
Molecular weight			36.63

Storage			-70°C
Other names
Grade			Purified
Purity			Glutathione Sepharose 4 Fast Flow.
Form			Supplied as a liquid in elution buffer, 50mM Tris-HCI, 10mM reduced glutathione, pH 8.0.
Reactivity life			12 months
Note			For reserch purpose only
Purity			Glutathione Sepharose 4 Fast Flow.
Description			GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified. Source: Recombinant protein corresponding to aa401-500 from human GABRA4 partial ORF, fused to GST tag at N-terminal, expressed in wheat germ (in vitro). Molecular Weight: ~36.63kD AA Sequence: GNRTEVGNHSSKSSTVVQESSKGTPRSYLASSPNPFSRANAAETISAARALPSASPTSIRTGYMPRKASVGSASTRHVFGSRLQRIKTTVNTIGATGKLS Applications: Suitable for use in ELISA, Western Blot, Antibody Production and Protein Array. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.