GLP1R, Recombinant, Human, aa24-145, His-Tag (Glucagon-like Peptide 1 Receptor)
Catalog No : USB-370627
428.75€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | GLP1R, Recombinant, Human, aa24-145, His-Tag (Glucagon-like Peptide 1 Receptor) | ||
|---|---|---|---|
| Catalog No | USB-370627 | ||
| Supplier’s Catalog No | 370627 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 18.4 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Source: Partial recombinant protein corresponding to aa24-145 from human GLP1R, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~18.4kD AA Sequence: RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved