GLP1R, Recombinant, Human, aa24-145, His-Tag (Glucagon-like Peptide 1 Receptor)

Catalog No : USB-370627
428.75€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name GLP1R, Recombinant, Human, aa24-145, His-Tag (Glucagon-like Peptide 1 Receptor)
Catalog No USB-370627
Supplier’s Catalog No 370627
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 18.4
Storage -20°C
Other names
Grade Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Source: Partial recombinant protein corresponding to aa24-145 from human GLP1R, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~18.4kD AA Sequence: RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.