Glp1r, Recombinant, Mouse, aa22-145, His-SUMO-Tag (Glucagon-like Peptide 1 Receptor)
Catalog No : USB-370628
527.60€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Glp1r, Recombinant, Mouse, aa22-145, His-SUMO-Tag (Glucagon-like Peptide 1 Receptor) | ||
|---|---|---|---|
| Catalog No | USB-370628 | ||
| Supplier’s Catalog No | 370628 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | |||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~85% (SDS-PAGE) | ||
| Form | Supplied as a liquid in 100mM Tris-HCl, pH 8.0, 0.4M Arg. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~85% (SDS-PAGE) | ||
| Description | This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Source: Recombinant protein corresponding to aa22-145 from partial mouse Glp1r, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. AA Sequence: GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLY Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved