Avpr1a, Recombinant, Rat, aa7-52, GST-Tag (Vasopressin V1a Receptor)
Catalog No : USB-372396
471.28€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Avpr1a, Recombinant, Rat, aa7-52, GST-Tag (Vasopressin V1a Receptor) | ||
|---|---|---|---|
| Catalog No | USB-372396 | ||
| Supplier’s Catalog No | 372396 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 32.3 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger system. Involved in social memory formation. Source: Recombinant protein corresponding to aa7-52 from rat Avpr1a, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~32.3kD AA Sequence: SQDRSVGNSSPWWPLTTEGSNGSQEAARLGEGDSPLGDVRNEELAK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved