Chrna1, Recombinant, Mouse, aa21-230, His-Tag (Acetylcholine Receptor Subunit alpha)

Catalog No : USB-372764
471.28€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Chrna1, Recombinant, Mouse, aa21-230, His-Tag (Acetylcholine Receptor Subunit alpha)
Catalog No USB-372764
Supplier’s Catalog No 372764
Supplier US Biologicals
Source antigen Recombinant, Yeast
Reactivity
Cross reactivity
Applications
Molecular weight 26.5
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. Source: Recombinant protein corresponding to aa21-230 from mouse Chrna1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~26.5kD AA Sequence: SEHETRLVAKLFEDYSSVVRPVEDHREIVQVTVGLQLIQLINVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDFAIVKFTKVLLDYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKEARGWKHWVFYSCCPTTPYLDITYHFVMQRL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.