Clec4a, Recombinant, Mouse, aa70-238, His-SUMO-Tag (C-type Lectin Domain Family 4 Member A)
Catalog No : USB-372782
506.91€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Clec4a, Recombinant, Mouse, aa70-238, His-SUMO-Tag (C-type Lectin Domain Family 4 Member A) | ||
|---|---|---|---|
| Catalog No | USB-372782 | ||
| Supplier’s Catalog No | 372782 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 39.6 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | May be involved in regulating immune reactivity. May play a role in modulating dendritic cells (DC) differentiation and/or maturation. May be involved in the inhibition of B-cell-receptor-mediated calcium mobilization and protein tyrosine phosphorylation. Source: Recombinant protein corresponding to aa70-238 from mouse Clec4a, fused to His-SUMO-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~39.6kD AA Sequence: QKYSQLLEEKKAAKNIMHNELNCTKSVSPMEDKVWSCCPKDWRLFGSHCYLVPTVSSSASWNKSEENCSRMGAHLVVIQSQEEQDFITGILDTHAAYFIGLWDTGHRQWQWVDQTPYEESITFWHNGEPSSGNEKCATIIYRWKTGWGWNDISCSLKQKSVCQMKKINL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved