DNRA, Recombinant, Human, aa21-80, His-Tag (Endothelin-1 Receptor)

Catalog No : USB-373087
445.99€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name DNRA, Recombinant, Human, aa21-80, His-Tag (Endothelin-1 Receptor)
Catalog No USB-373087
Supplier’s Catalog No 373087
Supplier US Biologicals
Source antigen Recombinant, Yeast
Reactivity
Cross reactivity
Applications
Molecular weight 8.8
Storage -20°C
Other names
Grade Purified
Purity ~85% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~85% (SDS-PAGE)
Description Receptor for endothelin-1. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of binding affinities for ET-A is: ET1 > ET2 >> ET3. Source: Recombinant protein corresponding to aa21-80 from human DNRA, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~8.8kD AA Sequence: DNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.