FCER1G, Recombinant, Human, aa19-86, GST-Tag (High Affinity Immunoglobulin Epsilon Receptor Subunit gamma)
Catalog No : USB-373296
428.75€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | FCER1G, Recombinant, Human, aa19-86, GST-Tag (High Affinity Immunoglobulin Epsilon Receptor Subunit gamma) | ||
|---|---|---|---|
| Catalog No | USB-373296 | ||
| Supplier’s Catalog No | 373296 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 34.8 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Associates with a variety of FcR alpha chains to form a functional signaling complex. Regulates several aspects of the immune response. The gamma subunit has a critical role in allowing the IgE Fc receptor to reach the cell surface. Also involved in collagen-mediated platelet activation and in neutrophil activation mediated by integrin. Source: Recombinant protein corresponding to aa19-86 from human FCER1G, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~34.8kD AA Sequence: LGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved