GABARAP, Recombinant, Human, aa2-117, GST-Tag (Gamma-aminobutyric Acid Receptor-associated Protein)
Catalog No : USB-373379
428.75€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | GABARAP, Recombinant, Human, aa2-117, GST-Tag (Gamma-aminobutyric Acid Receptor-associated Protein) | ||
|---|---|---|---|
| Catalog No | USB-373379 | ||
| Supplier’s Catalog No | 373379 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 40.8 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Ubiquitin-like modifier that plays a role in intracellular transport of GABA(A) receptors and its interaction with the cytoskeleton. Involved in apoptosis. Involved in autophagy. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation. Source: Recombinant protein corresponding to aa2-117 from human GABARAP, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~40.8kD AA Sequence: KFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved