ILDR2, Recombinant, Human, aa1-186, His-Tag (Immunoglobulin-like Domain-containing Receptor 2)

Catalog No : USB-373841
445.99€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name ILDR2, Recombinant, Human, aa1-186, His-Tag (Immunoglobulin-like Domain-containing Receptor 2)
Catalog No USB-373841
Supplier’s Catalog No 373841
Supplier US Biologicals
Source antigen Recombinant, Yeast
Reactivity
Cross reactivity
Applications
Molecular weight 23.1
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description May be involved in lipid homeostasis and ER stress pathways. Source: Recombinant protein corresponding to aa1-186 from human ILDR2, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~23.1kD AA Sequence: MDRVLLRWISLFWLTAMVEGLQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRGREITIVHDADLQIGKLMWGDSGLYYCIITTPDDLEGKNEDSVELLVLGRTGLLADLLPSFAVEIMPE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.