KIR2DS1, Recombinant, Human, aa22-245, His-Tag (Killer Cell Immunoglobulin-like Receptor 2DS1)

Catalog No : USB-373921
445.99€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name KIR2DS1, Recombinant, Human, aa22-245, His-Tag (Killer Cell Immunoglobulin-like Receptor 2DS1)
Catalog No USB-373921
Supplier’s Catalog No 373921
Supplier US Biologicals
Source antigen Recombinant, Yeast
Reactivity
Cross reactivity
Applications
Molecular weight 26.8
Storage -20°C
Other names
Grade Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells. Source: Partial recombinant protein corresponding to aa22-245 from human KIR2DS1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~26.8kD AA Sequence: HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMRQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGTKVNGTFQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.