KLRG1, Recombinant, Human, aa60-195, His-SUMO-Tag (Killer Cell Lectin-like Receptor Subfamily G Member 1)
Catalog No : USB-373940
428.75€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | KLRG1, Recombinant, Human, aa60-195, His-SUMO-Tag (Killer Cell Lectin-like Receptor Subfamily G Member 1) | ||
|---|---|---|---|
| Catalog No | USB-373940 | ||
| Supplier’s Catalog No | 373940 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 31.5 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Affinity Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in 10mM Tris-HCl, 1mM EDTA, pH 8.0, 50% glycerol | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Plays an inhibitory role on natural killer (NK) cells and T-cell functions upon binding to their non-MHC ligands. May mediate missing self recognition by binding to a highly conserved site on classical cadherins, enabling it to monitor expression of E-cadherin/CDH1, N-cadherin/CDH2 and R-cadherin/CDH4 on target cells. Source: Recombinant protein corresponding to aa60-195 from human KLRG1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli (Q96E93). Molecular Weight: ~31.5kD Amino Acid Sequence: LCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKCPFADQALF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved