LILRB3, Recombinant, Mouse, aa664-841, His-Tag (Leukocyte Immunoglobulin-like Receptor Subfamily B Member 3)
Catalog No : USB-374044
471.28€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | LILRB3, Recombinant, Mouse, aa664-841, His-Tag (Leukocyte Immunoglobulin-like Receptor Subfamily B Member 3) | ||
|---|---|---|---|
| Catalog No | USB-374044 | ||
| Supplier’s Catalog No | 374044 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, Yeast | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 21.6 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~85% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~85% (SDS-PAGE) | ||
| Description | May act as receptor for class I MHC antigens. Becomes activated upon coligation of LILRB3 and immune receptors, such as FCGR2B and the B-cell receptor. Down-regulates antigen-induced B-cell activation by recruiting phosphatases to its immunoreceptor tyrosine-based inhibitor motifs (ITIM). Source: Recombinant protein corresponding to aa664-841 from mouse LILRB3, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~21.6kD AA Sequence: RRRHRGKFRKDVQKEKDLQLSSGAEEPITRKGELQKRPNPAAATQEESLYASVEDMQTEDGVELNSWTPPEEDPQGETYAQVKPSRLRKAGHVSPSVMSREQLNTEYEQAEEGQGANNQAAESGESQDVTYAQLCSRTLRQGAAASPLSQAGEAPEEPSVYATLAAARPEAVPKDMEQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved