TREM2, Recombinant, Human, aa19-174, His-Tag (Triggering Receptor expressed on myeloid Cells 2)

Catalog No : USB-375669
428.75€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name TREM2, Recombinant, Human, aa19-174, His-Tag (Triggering Receptor expressed on myeloid Cells 2)
Catalog No USB-375669
Supplier’s Catalog No 375669
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 21.4
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description May have a role in chronic inflammations and may stimulate production of constitutive rather than inflammatory chemokines and cytokines. Forms a receptor signaling complex with TYROBP and triggers activation of the immune responses in macrophages and dendritic cells. Source: Recombinant protein corresponding to aa19-174 from human TREM2, fused to His-Tag at N-terminal expressed in E. coli. Molecular Weight: ~21.4kD AA Sequence: HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.