Nectin-2, Recombinant, Human, aa32-360, His-Tag (NECTIN2)
Catalog No : USB-516815
396.56€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Nectin-2, Recombinant, Human, aa32-360, His-Tag (NECTIN2) | ||
|---|---|---|---|
| Catalog No | USB-516815 | ||
| Supplier’s Catalog No | 516815 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, Mammalian cell | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 36.58 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ≥95% (SDS-PAGE) | ||
| Form | Supplied as a lyophilized powder in 20mM PBS, pH 7.2. | ||
| Reactivity life | |||
| Note | For reserch purpose only | ||
| Purity | ≥95% (SDS-PAGE) | ||
| Description | Modulator of T-cell signaling. Can be either a costimulator of T-cell function, or a coinhibitor, depending on the receptor it binds to. Upon binding to CD226, stimulates T-cell proliferation and cytokine production, including that of IL2, IL5, IL10, IL13, and IFNG. Upon interaction with PVRIG, inhibits T-cell proliferation. These interactions are competitive. Source: Recombinant partial protein corresponding to aa32-360 of human Nectin-2, fused to His-Tag at C-terminal, expressed in mammalian cell. Molecular Weight: ~36.58kD Biological Activity: The ED50 as determined by its ability to bind human DNAM-1 in functional ELISA is ≤10ug/ml. Endotoxin: <1EU/ug (LAL). AA Sequence: QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPNTAGAGATGG Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile buffer or ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved