Tumor Necrosis Factor Receptor Superfamily Member 14, Recombinant, Mouse, aa39-207, Fc-Tag (Tnfrsf14)

Catalog No : USB-516822
374.72€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Tumor Necrosis Factor Receptor Superfamily Member 14, Recombinant, Mouse, aa39-207, Fc-Tag (Tnfrsf14)
Catalog No USB-516822
Supplier’s Catalog No 516822
Supplier US Biologicals
Source antigen Recombinant, Mammalian cell
Reactivity
Cross reactivity
Applications
Molecular weight 45.6
Storage -20°C
Other names
Grade Highly Purified
Purity ≥95% (SDS-PAGE)
Form Supplied as a lyophilized powder in 20mM PBS, pH 7.4.
Reactivity life
Note For reserch purpose only
Purity ≥95% (SDS-PAGE)
Description Tumor necrosis factor receptor superfamily member 14 (TNFRSF14), also known as HVEM, is a protein that in humans is encoded by the TNFRSF14 gene. The protein encoded by this gene is a member of the TNF-receptor superfamily. It is mapped to 1p36.32. HVEM plays an important role in HSV pathogenesis because it enhanced the entry of several wildtype HSV strains of both serotypes into CHO cells, and mediated HSV entry into activated human T cells. HVEM and BTLA which are form a bidirectional signaling pathway can regulate cell survival and inhibitory responses between interacting cells. HVEM as an important orchestrator of mucosal immunity integrates signals from innate lymphocytes to induce optimal epithelial Stat3 activation, which indicated that targeting HVEM with agonists could improve host defense. Source: Recombinant partial protein corresponding to aa39-207 of mouse Tumor Necrosis Factor Receptor Superfamily Member 14, fused to Fc-Tag at C-terminal, expressed in mammalian cell. Molecular Weight: ~45.6kD Biological Activity: The ED50 as determined by its ability to bind human BTLA in functional ELISA is typically 1.17ug/ml. Endotoxin: <1EU/ug (LAL). AA Sequence: QPSCRQEEFLVGDECCPMCNPGYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEECLPWTNCSAFQQEVRRGTNSTDTTCSSQV Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile buffer or ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.