Imugex

Shipping cost plus VAT not included , delivery in 7-14 business days

Categories: Peptides & Proteins / Proteins

Product name			Tumor Necrosis Factor Receptor Superfamily Member 4, Recombinant, Mouse, aa20-211, Fc-Tag (Tnfrsf4)
Catalog No			USB-516825
Supplier’s Catalog No			516825
Supplier			US Biologicals
Source antigen			Recombinant, Mammalian cell
Reactivity
Cross reactivity
Applications
Molecular weight			48.1

Storage			-20°C
Other names
Grade			Highly Purified
Purity			≥95% (SDS-PAGE)
Form			Supplied as a lyophilized powder in PBS, pH 7.4.
Reactivity life
Note			For reserch purpose only
Purity			≥95% (SDS-PAGE)
Description			Receptor for TNFSF4/OX40L/GP34. Is a costimulatory molecule implicated in long-term T-cell immunity (By similarity). Source: Recombinant partial protein corresponding to aa20-211 of mouse Tumor Necrosis Factor Receptor Superfamily Member 4, fused to Fc-Tag at C-terminal, expressed in mammalian cell. Molecular Weight: ~48.1kD Biological Activity: The ED50 as determined by its ability to bind mouse TNFSF4 in functional ELISA is less than 2ug/ml. Endotoxin: <1EU/ug (LAL). AA Sequence: VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGP Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile buffer or ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.