fMet-Leu-Phe Receptor, Recombinant, Human, aa306-350, His-GST-Tag, Myc-Tag (FPR1)

Catalog No : USB-517911
506.91€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name fMet-Leu-Phe Receptor, Recombinant, Human, aa306-350, His-GST-Tag, Myc-Tag (FPR1)
Catalog No USB-517911
Supplier’s Catalog No 517911
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 34.9
Storage -20°C
Other names
Grade Purified
Purity ~85% (SDS-PAGE)
Form Supplied as a liquid in Tris-based buffer, 50% glycerol.
Reactivity life
Note For reserch purpose only
Purity ~85% (SDS-PAGE)
Description High affinity receptor for N-formyl-methionyl peptides (fMLP), which are powerful neutrophil chemotactic factors. Binding of fMLP to the receptor stimulates intracellular calcium mobilization and superoxide anion release. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. Source: Recombinant protein corresponding to aa306-350 of human fMet-Leu-Phe Receptor, fused to 10xHis-GST-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~34.9kD AA Sequence: QDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.