Folate Receptor Beta, Recombinant, Human, aa19-230, His-Tag (FOLR2)
Catalog No : USB-517913
462.08€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Folate Receptor Beta, Recombinant, Human, aa19-230, His-Tag (FOLR2) | ||
|---|---|---|---|
| Catalog No | USB-517913 | ||
| Supplier’s Catalog No | 517913 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, Baculovirus | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 27.1 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~85% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris-based buffer, 50% glycerol. | ||
| Reactivity life | |||
| Note | For reserch purpose only | ||
| Purity | ~85% (SDS-PAGE) | ||
| Description | Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate and folate analogs into the interior of cells. Has high affinity for folate and folic acid analogs at neutral pH. Exposure to slightly acidic pH after receptor endocytosis triggers a conformation change that strongly reduces its affinity for folates and mediates their release. Source: Recombinant protein corresponding to aa19-230 of human Folate Receptor Beta, fused to 10xHis-Tag at N-terminal, expressed in Baculovirus. Molecular Weight: ~27.1kD AA Sequence: CSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
© 2020 Imugex All Rights Reserved