Imugex

Shipping cost plus VAT not included , delivery in 7-14 business days

Categories: Peptides & Proteins / Proteins

Product name			Folate Receptor Beta, Recombinant, Human, aa19-230, His-Tag (FOLR2)
Catalog No			USB-517913
Supplier’s Catalog No			517913
Supplier			US Biologicals
Source antigen			Recombinant, Baculovirus
Reactivity
Cross reactivity
Applications
Molecular weight			27.1

Storage			-20°C
Other names
Grade			Purified
Purity			~85% (SDS-PAGE)
Form			Supplied as a liquid in Tris-based buffer, 50% glycerol.
Reactivity life
Note			For reserch purpose only
Purity			~85% (SDS-PAGE)
Description			Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate and folate analogs into the interior of cells. Has high affinity for folate and folic acid analogs at neutral pH. Exposure to slightly acidic pH after receptor endocytosis triggers a conformation change that strongly reduces its affinity for folates and mediates their release. Source: Recombinant protein corresponding to aa19-230 of human Folate Receptor Beta, fused to 10xHis-Tag at N-terminal, expressed in Baculovirus. Molecular Weight: ~27.1kD AA Sequence: CSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.