Glucagon-Like Peptide 1 Receptor, Recombinant Human, aa24-145, His-Tag (GLP1R)

Catalog No : USB-517923
504.61€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Glucagon-Like Peptide 1 Receptor, Recombinant Human, aa24-145, His-Tag (GLP1R)
Catalog No USB-517923
Supplier’s Catalog No 517923
Supplier US Biologicals
Source antigen Recombinant, Baculovirus
Reactivity
Cross reactivity
Applications
Molecular weight 16.8
Storage -20°C
Other names
Grade Purified
Purity ~85% (SDS-PAGE)
Form Supplied as a liquid in Tris-based buffer, 50% glycerol.
Reactivity life
Note For reserch purpose only
Purity ~85% (SDS-PAGE)
Description This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Source: Partial recombinant protein corresponding to aa24-145 of human Glucagon-Like Peptide 1 Receptor, fused to 10xHis-Tag at N-terminal, expressed in Baculovirus. Molecular Weight: ~16.8kD AA Sequence: RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.