Glucagon-Like Peptide 1 Receptor, Recombinant Human, aa24-145, His-Tag (GLP1R)
Catalog No : USB-517923
504.61€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Glucagon-Like Peptide 1 Receptor, Recombinant Human, aa24-145, His-Tag (GLP1R) | ||
|---|---|---|---|
| Catalog No | USB-517923 | ||
| Supplier’s Catalog No | 517923 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, Baculovirus | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 16.8 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~85% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris-based buffer, 50% glycerol. | ||
| Reactivity life | |||
| Note | For reserch purpose only | ||
| Purity | ~85% (SDS-PAGE) | ||
| Description | This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Source: Partial recombinant protein corresponding to aa24-145 of human Glucagon-Like Peptide 1 Receptor, fused to 10xHis-Tag at N-terminal, expressed in Baculovirus. Molecular Weight: ~16.8kD AA Sequence: RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
© 2020 Imugex All Rights Reserved