Killer Cell Immunoglobulin-Like Receptor 2DS3, Recombinant, Human, aa22-245, His-Tag (KIR2DS3)
Catalog No : USB-517978
471.28€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Killer Cell Immunoglobulin-Like Receptor 2DS3, Recombinant, Human, aa22-245, His-Tag (KIR2DS3) | ||
|---|---|---|---|
| Catalog No | USB-517978 | ||
| Supplier’s Catalog No | 517978 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, Yeast | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 26.7 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris-based buffer, 50% glycerol. | ||
| Reactivity life | |||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells. Source: Partial recombinant protein corresponding to aa22-245 of human Killer Cell Immunoglobulin-Like Receptor 2DS3, fused to 6xHis-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~26.7kD AA Sequence: HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
© 2020 Imugex All Rights Reserved