Ribosome-inactivating Protein Karasurin-C, Recombinant, Trichosanthes Kirilowii, aa22-270, His-SUMO-Tag
Catalog No : USB-375063
506.91€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Ribosome-inactivating Protein Karasurin-C, Recombinant, Trichosanthes Kirilowii, aa22-270, His-SUMO-Tag | ||
|---|---|---|---|
| Catalog No | USB-375063 | ||
| Supplier’s Catalog No | 375063 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 43.4 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Abortion-inducing protein. It inactivates eukaryotic 60S ribosomal subunits. Source: Recombinant protein corresponding to aa22-270 from trichosanthes kirilowii Ribosome-inactivating protein karasurin-C, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~43.4kD AA Sequence: EGDVSFRLSGATSSSYGVFISNLRKALPYERKLYDIPLLRSTLPGSQRYALIHLTNYADETISVAIDVTNVYVMGYRAGDTSYFFNEASATEAAKYVFKDAKRKVTLPYSGNYERLQIAAGKIRENIPLGLPALDSAITTLFYYNANSAASALMVLIQSTSEAARYKFIEQQIGKRVDKTFLPSLAIISLENSWSALSKQIQIASTNNGQFETPVVLINAQNQRVTITNVDAGVVTSNIALLLNRNNMA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved