RPL36AL, Recombinant, Human, aa1-106, GST-Tag (60S Ribosomal Protein L36a-like)

Catalog No : USB-375106
428.75€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name RPL36AL, Recombinant, Human, aa1-106, GST-Tag (60S Ribosomal Protein L36a-like)
Catalog No USB-375106
Supplier’s Catalog No 375106
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 39.5
Storage -20°C
Other names
Grade Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Belongs to the ribosomal protein L44e family. Source: Recombinant protein corresponding to aa1-106 from RPL36AL, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.5kD AA Sequence: MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQGRRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.