RpsH, Recombinant, E. coli, aa2-130, His-Tag (30S Ribosomal Protein S8)
Catalog No : USB-375151
506.91€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | RpsH, Recombinant, E. coli, aa2-130, His-Tag (30S Ribosomal Protein S8) | ||
|---|---|---|---|
| Catalog No | USB-375151 | ||
| Supplier’s Catalog No | 375151 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 18 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | One of the primary rRNA binding proteins, it binds directly to 16S rRNA central domain where it helps coordinate assembly of the platform of the 30S subunit. Protein S8 is a translational repressor protein, it controls the translation of the spc operon by binding to its mRNA. Source: Recombinant protein corresponding to aa2-130 from E. coli rpsH, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~18.0kD AA Sequence: SMQDPIADMLTRIRNGQAANKAAVTMPSSKLKVAIANVLKEEGFIEDFKVEGDTKPELELTLKYFQGKAVVESIQRVSRPGLRIYKRKDELPKVMAGLGIAVVSTSKGVMTDRAARQAGLGGEIICYVA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved