RpsM, Recombinant, E. coli, aa2-118, GST-Tag (30S Ribosomal Protein S13)

Catalog No : USB-375154
506.91€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name RpsM, Recombinant, E. coli, aa2-118, GST-Tag (30S Ribosomal Protein S13)
Catalog No USB-375154
Supplier’s Catalog No 375154
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 40
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. Source: Recombinant protein corresponding to aa2-118 from E. coli rpsM, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~40.0kD AA Sequence: ARIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEGQIDTLRDEVAKFVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQRTKTNARTRKGPRKPIKK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.