60S Ribosomal Protein L10, Recombinant, Drosophila Melanogaster, aa1-218, His-Tag (RpL10)

Catalog No : USB-517782
506.91€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name 60S Ribosomal Protein L10, Recombinant, Drosophila Melanogaster, aa1-218, His-Tag (RpL10)
Catalog No USB-517782
Supplier’s Catalog No 517782
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 29.5
Storage -20°C
Other names
Grade Purified
Purity ~85% (SDS-PAGE)
Form Supplied as a liquid in Tris-based buffer, 50% glycerol.
Reactivity life
Note For reserch purpose only
Purity ~85% (SDS-PAGE)
Description Source: Recombinant full length protein corresponding to aa1-218 of Drosophila Melanogaster 60S Ribosomal Protein L10, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~29.5kD AA Sequence: MGRRPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLGRKKATVEDFPLCVHLVSDEYEQLSSEALEAGRICCNKYLVKYCGKDQFHIRMRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVRIGQPIMSVRSSDRYKAQVIEALRRAKFKFPGRQKIYVSKKWGFTKYERERYEELRDDNRLEPDGCNVKYRPEHGPIAAWEKAQRDVYA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.