NHP2L1, Recombinant, Human, aa2-128, His-Tag (NHP2-like Protein 1)
Catalog No : USB-374419
445.99€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | NHP2L1, Recombinant, Human, aa2-128, His-Tag (NHP2-like Protein 1) | ||
|---|---|---|---|
| Catalog No | USB-374419 | ||
| Supplier’s Catalog No | 374419 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, Yeast | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 16 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~85% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~85% (SDS-PAGE) | ||
| Description | Binds to the 5'-st-loop of U4 snRNA and may play a role in the late stage of spliceosome assembly. The protein undergoes a conformational change upon RNA-binding. Source: Recombinant protein corresponding to aa2-128 from human NHP2L1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~16kD AA Sequence: TEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved