SEPP1, Recombinant, Human, aa20-381, His-Tag (Selenoprotein P)
Catalog No : USB-375250
428.75€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | SEPP1, Recombinant, Human, aa20-381, His-Tag (Selenoprotein P) | ||
|---|---|---|---|
| Catalog No | USB-375250 | ||
| Supplier’s Catalog No | 375250 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 44.6 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Might be responsible for some of the Extracellular domain antioxidant defense properties of selenium or might be involved in the transport of selenium. May supply selenium to tissues such as brain and testis. Source: Recombinant protein corresponding to aa20-381 from human SEPP1, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~44.6kD AA Sequence: ESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVALLQASSYLCILQASKLEDLRVKLKKEGYSNISYIVVNHQGISSRLKYTHLKNKVSEHIPVYQQEENQTDVWTLLNGSKDDFLIYDRCGRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCGNCSLTTLKDEDFCKRVSLATVDKTVETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQHRQGHPENRDMPASEDLQDLQKKLCRKRCINQLLCKLPTDSELAPRSSCCHCRHLIFEKTGSAITSQCKENLPSLCSSQGLRAEENITESCQSRLPPAASQISQQLIPTEASASSRSKNQAKKSESPSN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved