Myoglobin, Recombinant, Human, His-Tag (MB, MGC13548, PVALB)
Catalog No : USB-138169
665.54€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Myoglobin, Recombinant, Human, His-Tag (MB, MGC13548, PVALB) | ||
|---|---|---|---|
| Catalog No | USB-138169 | ||
| Supplier’s Catalog No | 138169 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E.coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 19.3 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in 20mM Tris-HCl, pH 8.0, 1mM DTT, 100mM sodium chloride, 10% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Myoglobin, mitochondrial precursor, also known as MB, is a cytosolic oxygen-binding protein responsible for the storage and diffusion of oxygen within myocytes. Expression of myoglobin is highest in skeletal and cardiac muscle. MB may serve a variety of functions in muscular oxygen supply, such as oxygen storage, facilitated diffusion, and myoglobin-mediated oxidative phosphorylation. Recombinant human MB protein, fused to His-tag at N-terminal domain, was expressed in E.coli and purified by using conventional chromatography techniques. Source: Recombinant protein corresponding to aa1-154 from human Myoglobin, fused to His-tag at N-terminal domain, expressed in E.coli. Molecular Weight: ~19.3kD (MALDI-TOF) Applications: Suitable for use in SDS-PAGE. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGSSHHHHHHSSGLVPRGSHMGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
© 2020 Imugex All Rights Reserved