Imugex

Shipping cost plus VAT not included , delivery in 7-14 business days

Categories: Peptides & Proteins / Proteins

Product name			Myoglobin, Recombinant, Mouse aa2-154, His-tag, Myc-tag (Mb)
Catalog No			USB-405997
Supplier’s Catalog No			405997
Supplier			US Biologicals
Source antigen			Recpbnant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight			21.9

Storage			-20°C
Other names
Grade			Purified
Purity			~90% (SDS-PAGE)
Form			Supplied as a liquid in Tris, 50% glycerol.
Reactivity life			6 months
Note			For reserch purpose only
Purity			~90% (SDS-PAGE)
Description			Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles. Source: Recombinant protein corresponding to aa2-154 from mouse Myoglobin, fused to His-tag at N-terminal and fused to Myc-tag at C-terminal, expressed in E. coli. Molecular Weight: ~21.9kD A Sequence: GLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.