Imugex

Shipping cost plus VAT not included , delivery in 7-14 business days

Categories: Peptides & Proteins / Proteins

Product name			PHIP (BD1), Recombinant, Human, aa1146-1287, His-Tag (Bromodomain Pleckstrin Homology Domain Interacting Protein, IRS-1 PH Domain-Binding Protein, WDR11, BRWD2)
Catalog No			USB-298447
Supplier’s Catalog No			298447
Supplier			US Biologicals
Source antigen			Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight			17

Storage			-70°C
Other names
Grade			Highly Purified
Purity			Highly Purified (~90%)
Form			Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 20% glycerol.
Reactivity life			12 months
Note			For reserch purpose only
Purity			Highly Purified (~90%)
Description			PHIP is a bromodomain-containing protein that binds the pleckstrin homology (PH) domain of insulin receptor substrate-1 (IRS1), modulates insulin signaling, and plays a role in pancreatic beta cell growth and survival. It stimulates cell proliferation through regulation of cyclin transcription and has an anti-apoptotic activity through AKT1 phosphorylation and activation. Source: Recombinant protein corresponding to bromodomain 1, aa1146-1287, from human PHIP, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~17kD AA Sequence: MHHHHHHSLIYKPLDGEWGTNPRDEECERIVAGINQLMTLDIASAFVAPVDLQAYPMY CTVVAYPTDLSTIKQRLENRFYRRVSSLMWEVRYIEHNTRTFNEPGSPIVKSAKFVTDL LLHFIKDQTCYNIIPLYNSMKKKVLSDSEDEE Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.