ASCC3, Recombinant, Human, aa1-111, GST-Tag (Activating Signal Cointegrator 1 Complex Subunit 3)
Catalog No : USB-372351
448.29€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | ASCC3, Recombinant, Human, aa1-111, GST-Tag (Activating Signal Cointegrator 1 Complex Subunit 3) | ||
|---|---|---|---|
| Catalog No | USB-372351 | ||
| Supplier’s Catalog No | 372351 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 40 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | 3'-5' DNA helicase involved in repair of alkylated DNA. Promotes DNA unwinding to generate single-stranded substrate needed for ALKBH3, enabling ALKBH3 to process alkylated N3-methylcytosine (3mC) within double-stranded regions. Enhances NF-kappa-B, SRF and AP1 transactivation. Source: Recombinant protein corresponding to aa1-111 from human ASCC3, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~40.0kD AA Sequence: MALPRLTGALRSFSNVTKQDNYNEEVADLKIKRSKLHEQVLDLGLTWKKIIKFLNEKLEKSKMQSINEDLKDILHAAKQIEVNCPFQKRRLDGKEEDEKMSRASDRFRGLR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved