MPV17, Recombinant, Human, aa1-176, His-SUMO-Tag (Protein Mpv17)

Catalog No : USB-374256
428.75€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name MPV17, Recombinant, Human, aa1-176, His-SUMO-Tag (Protein Mpv17)
Catalog No USB-374256
Supplier’s Catalog No 374256
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 35.7
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Involved in mitochondria homeostasis. May be involved in the metabolism of reactive oxygen species and control of oxidative phosphorylation and mitochondrial DNA (mtDNA) maintenance. Source: Recombinant protein corresponding to aa1-176 from human MPV17, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~35.7kD AA Sequence: MALWRAYQRALAAHPWKVQVLTAGSLMGLGDIISQQLVERRGLQEHQRGRTLTMVSLGCGFVGPVVGGWYKVLDRFIPGTTKVDALKKMLLDQGGFAPCFLGCFLPLVGALNGLSAQDNWAKLQRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAVIWNSYLSWKAHRL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.