SHH, Recombinant, Human (Sonic Hedgehog Protein, HHG-1, Sonic Hedgehog Protein N-product, Sonic Hedgehog Protein C-product)
Catalog No : USB-143504
354.03€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | SHH, Recombinant, Human (Sonic Hedgehog Protein, HHG-1, Sonic Hedgehog Protein N-product, Sonic Hedgehog Protein C-product) | ||
|---|---|---|---|
| Catalog No | USB-143504 | ||
| Supplier’s Catalog No | 143504 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | |||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ≥98% by SDS-PAGE gel and HPLC analyses. | ||
| Form | Supplied as a lyophilized powder. | ||
| Reactivity life | 12 months | ||
| Note | For reserch purpose only | ||
| Purity | ≥98% by SDS-PAGE gel and HPLC analyses. | ||
| Description | Members of the Hedgehog (Hh) family are highly conserved proteins which are widely represented throughout the animal kingdom. The three known mammalian Hh proteins, Sonic (Shh), Desert (Dhh) and Indian (Ihh) are structurally related and share a high degree of aa sequence identity (e.g., Shh and Ihh are 93% identical). The biologically active form of Hh molecules is obtained by autocatalytic cleavage of their precursor proteins and corresponds to approximately the N-terminal one half of the precursor molecule. Although Hh proteins have unique expression patterns and distinct biological roles within their respective regions of secretion, they use the same signaling pathway and can substitute for each other in experimental systems. Recombinant E. coli derived Human Sonic HedgeHog is a 20kD protein consisting of 176aa residues, including an N-terminal Ile-Val-Ile sequence substituted for the natural occurring chemically modified Cys residue. Biological Activity: Determined by its ability to induce alkaline phosphatase production by C3H/10T1/2 (CCL-226) cells. The expected ED50 for this effect is 0.8-1ug/ml. AA Sequence: IVIGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRALDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG Crossreactivity: Mouse Quality Control: Verified by N-terminal and Mass Spectrometry analyses (when applicable). Endotoxin: <0.1ng/ug of protein (<1EU/ug). Protein Content: Verified by UV Spectroscopy and/or SDS-PAGE gel. Storage and Stability: Store lyophilized products at -20°C. For reconstituted solutions of most products, we recommend short-term storage at 4°C. For longer term storage the protein solution should be stored with a carrier protein (eg. 0.1% BSA) in working aliquots and stored frozen at -20°C. Additional freeze/thaw cycles may cause some denaturation of the protein. | ||
Product Details
© 2020 Imugex All Rights Reserved