RBM3, Recombinant, Human, aa1-157, His-SUMO-Tag (Putative RNA-binding Protein 3)
Catalog No : USB-375002
428.75€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | RBM3, Recombinant, Human, aa1-157, His-SUMO-Tag (Putative RNA-binding Protein 3) | ||
|---|---|---|---|
| Catalog No | USB-375002 | ||
| Supplier’s Catalog No | 375002 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 32.2 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Cold-inducible mRNA binding protein that enhances global protein synthesis at both physiological and mild hypothermic temperatures. Reduces the relative abundance of microRNAs, when overexpressed. Enhances phosphorylation of translation initiation factors and active polysome formation. Source: Recombinant protein corresponding to aa1-157 from human RBM3, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~32.2kD AA Sequence: MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNYRDNYDN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved