SOD1, Recombinant, Mouse, aa2-154, His-Tag (Superoxide Dismutase [Cu-Zn])

Catalog No : USB-375370
471.28€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name SOD1, Recombinant, Mouse, aa2-154, His-Tag (Superoxide Dismutase [Cu-Zn])
Catalog No USB-375370
Supplier’s Catalog No 375370
Supplier US Biologicals
Source antigen Recombinant, Yeast
Reactivity
Cross reactivity
Applications
Molecular weight 17.8
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Destroys radicals which are normally produced within the cells and which are toxic to biological systems. Source: Recombinant protein corresponding to aa2-154 from mouse SOD1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~17.8kD AA Sequence: AMKAVCVLKGDGPVQGTIHFEQKASGEPVVLSGQITGLTEGQHGFHVHQYGDNTQGCTSAGPHFNPHSKKHGGPADEERHVGDLGNVTAGKDGVANVSIEDRVISLSGEHSIIGRTMVVHEKQDDLGKGGNEESTKTGNAGSRLACGVIGIAQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.