Synuclein, gamma, Recombinant, Mouse (BCSG1, SYN)
Catalog No : USB-209227
508.06€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Synuclein, gamma, Recombinant, Mouse (BCSG1, SYN) | ||
|---|---|---|---|
| Catalog No | USB-209227 | ||
| Supplier’s Catalog No | 209227 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 16 | ||
| Storage | -70°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | Highly Purified (~95%) | ||
| Form | Supplied as a liquid in PBS, pH 7.5. No preservative added. | ||
| Reactivity life | 12 months | ||
| Note | For reserch purpose only | ||
| Purity | Highly Purified (~95%) | ||
| Description | Parkinson's disease (PD) is a common neurodegenerative disorder with a lifetime incidence of ~2 percent; the clinical manifestations of this neurodegenerative disorder include resting tremor, muscular rigidity, bradykinesia, and postural instability. A relatively specific pathological feature accompanying the neuronal degeneration is an intracytoplasmic inclusion body, known as the Lewy body. A mutation was identified in the a- synuclein gene, which codes for a presynaptic protein thought to be involved in neuronal plasticity, this mutation may cause a conformational change that renders a-synuclein more prone to self aggregation and deposition in Lewy bodies, which finally leads to oxidative stress and misfolding of -synuclein. Parkin gene, mutations in this gene are reported in early autosomal-recessive form of PD, however these mutations do not degenerate Lewy bodies. The Parkin gene product (Parkin) is involved in protein degradation as a ubiquitin protein ligase, the known substrates of Parkin include Pael-R (Parkin-associated endothelin receptor-like receptor), Ubiquitination of Pael-R by Parkin leads to its degradation in the proteasome, however failure to ubiquitinate it leads to death of neuron. The synuclein exists in 3 isoform a-syn (chrm 4q21), a 140aa protein, implicated in pathogenesis of PD and related neurodegenerative disorders, it is mainly expressed in brain specifically in neuronal cell bodies and synapses. The 134aa beta-syn (chrm 5q35) is homologous to 14kD bovine phosphoneuroprotein 14; SCNB has been shown to be highly expressed in the substantia nigra of the brain. Recently a new isoform termed gamma-synuclein (SNCG) or breast cancer gene 1 (BCG1) has been cloned (human 127aa (chrm 10q23), rat/mouse 123aa). Higher levels of expression of SNCG have been reported in advanced breast carcinomas. All three synuclein show ~40% identity. Mouse Gamma synuclein recombinant protein, an acidic neuronal protein of 127aa. It is up regulated in the majority of late-stage breast and ovarian cancers, it promotes cancer cell survival and inhibits stress and chemotherapy drug induced apoptosis by modulating MAP kinase pathways. Source: Recombinant protein corresponding to 127aa from mouse gamma-Synuclein, expressed in E. coli. Molecular Weight: Migrates as ~16kD band in SDS-PAGE (reduced) AA Sequence: MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGTKTKEN VVQSVTSVAEKTKEQANAVSEAVVSSVNTVANKTVEEAENIVVTTGVV RKEDLEPPAQDQEAKEQEENEEAKS GED Applications: Suitable for use in ELISA standards or Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. | ||
Product Details
© 2020 Imugex All Rights Reserved