Synuclein, alpha, Human, aa1-95 (SNCA, MGC110988, Alpha-synuclein, Non-A beta Component of AD Amyloid, Non-A4 Component of Amyloid Precursor, NACP, NACP, PARK1)

Catalog No : USB-217823
771.29€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Synuclein, alpha, Human, aa1-95 (SNCA, MGC110988, Alpha-synuclein, Non-A beta Component of AD Amyloid, Non-A4 Component of Amyloid Precursor, NACP, NACP, PARK1)
Catalog No USB-217823
Supplier’s Catalog No 217823
Supplier US Biologicals
Source antigen E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 9391
Storage -20°C
Other names
Grade Highly Purified
Purity ~95% (SDS-PAGE)
Form Supplied as a lyophilized powder. Reconstitute with 500ul sterile dH2O.
Reactivity life 12 months
Note For reserch purpose only
Purity ~95% (SDS-PAGE)
Description Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Two alternatively spliced transcripts of SNCA have been identified. Additional splicing may be present but the full-length nature of these variants has not been determined. Source: Human Synuclein, a-synuclein, aa1-95, from E. coli. AA Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFV Molecular Weight: 9,391 Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile dH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.