Synuclein, alpha, Human, aa61-140 (SNCA, MGC110988, Alpha-synuclein, Non-A beta Component of AD Amyloid, Non-A4 Component of Amyloid Precursor, NACP, NACP, PARK1)
Catalog No : USB-217824
772.44€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Synuclein, alpha, Human, aa61-140 (SNCA, MGC110988, Alpha-synuclein, Non-A beta Component of AD Amyloid, Non-A4 Component of Amyloid Precursor, NACP, NACP, PARK1) | ||
|---|---|---|---|
| Catalog No | USB-217824 | ||
| Supplier’s Catalog No | 217824 | ||
| Supplier | US Biologicals | ||
| Source antigen | E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 8460 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~95% (SDS-PAGE) | ||
| Form | Supplied as a lyophilized powder. Reconstitute with 500ul sterile dH2O. | ||
| Reactivity life | 12 months | ||
| Note | For reserch purpose only | ||
| Purity | ~95% (SDS-PAGE) | ||
| Description | Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Two alternatively spliced transcripts of SNCA have been identified. Additional splicing may be present but the full-length nature of these variants has not been determined. Source: Human Synuclein, alpha, aa61-140, from E. coli AA Sequence: MEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA An additional amino acid (Met) is attached at the N-terminus. Molecular Weight: 8,460 Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile dH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
© 2020 Imugex All Rights Reserved