Alpha-synuclein, Recombinant, Rat, aa1-140, GST-Tag (Snca)

Catalog No : USB-370516
462.08€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Alpha-synuclein, Recombinant, Rat, aa1-140, GST-Tag (Snca)
Catalog No USB-370516
Supplier’s Catalog No 370516
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 41.9
Storage -20°C
Other names
Grade Purified
Purity ~85% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~85% (SDS-PAGE)
Description May be involved in the regulation of dopamine release and transport. Source: Recombinant protein corresponding to aa1-140 from rat Snca, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~41.9kD AA Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQMGKGEEGYPQEGILEDMPVDPSSEAYEMPSEEGYQDYEPEA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.