B7-H4, Recombinant, Human (B7x, B7S1, B7H4) (Biotin)
Catalog No : USB-172314
693.12€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | B7-H4, Recombinant, Human (B7x, B7S1, B7H4) (Biotin) | ||
|---|---|---|---|
| Catalog No | USB-172314 | ||
| Supplier’s Catalog No | 172314 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 28.6 | ||
| Storage | -70°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% | ||
| Form | Supplied as a liquid in 8mM phosphate, pH 7.4, 110mM sodium chloride, 2.2mM KCl, 20% glycerol. Labeled with Biotin. | ||
| Reactivity life | 12 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% | ||
| Description | Human secreted CD137, Fc fusion protein, also known as Tumor Necrosis Factor Receptor Superfamily member 9, TNFRSF9, and ILA, Recombinant protein corresponding to aa29-258 with C-terminal His-Avi-Tags from human B7-H4, expressed in HEK293 cell expression system. Amino Acid Sequence: FGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDE LSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTG AFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSF ELNSEN VTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNS KAHHHHHHHHHHGGGLNDIFEAQKIEWHE Applications: Suitable for use in the study of enzyme kinetics, screening inhibitors and selectivity profiling. Other applications not tested. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. | ||
Product Details
© 2020 Imugex All Rights Reserved